(data stored in ACNUC7421 zone)

EMBL: CP002355.PE393

CP002355.PE393       Location/Qualifiers
FT   CDS             complement(388778..390880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0394"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain;
FT                   InterProIPR000014: IPR000160: IPR013767: IPR013655: IPR
FT                   001633: IPR000215; KEGG: cyt:cce_2032 hypothetical protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold-3 domain protein; PAS fold domain protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein; SPTR: Diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(S); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain;
FT                   GGDEF domain; PAS fold; TIGRFAM: PAS domain S-box;
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33061"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ62"
FT                   /protein_id="ADR33061.1"
FT                   /translation="MQTEAPLYDVLNYLPDGIIMLDERGVILFANDAFSEMVGYKSDLL
FT                   LGLNMLSLLADITVFTECIAKVMKEGQSLDAETDFLHRDGHIVQAVKSVRMIRHNDHTR
FT                   FFVNVRNLTDLIQFNKELRASKELIELQAAELSFLLNSKHQEIEDILSSIDEVIWYIHN
FT                   QTLSLQYVNKAVETIFGFTKETFLSDTTLWQQQIHPEDRSLVQMFFETLAPGQSQEIRF
FT                   RILHCDGEVRWLNSRIHNHPKLNLFIGITSDITCSKAQSEEIAFLAYHDPLTHLPNRAK
FT                   LKLQLENRFEHAPNSPFALMFLDLDNFKNINDTMGHKIGDKILIEVSRRIRETVGKYDF
FT                   YARFGGDEFVILLQDADSASIDLTAQKLIQVFKEPCTLNETEFFLSASIGIVLYPDDAL
FT                   NGDDLIKHADTAMYEAKKKGKNQFAYYHTSMERAIHHFMYIESLIREGLTQNLFELYFQ
FT                   PLIDSKTLRMEGYEALLRLKHPHKGFIPPDTIIPVAEANGDIHLIGDKVLSQACDFIDA
FT                   LRALQDEPFFVAINVSAKQLQRNKFVQELFDYLALRSIPSSYLKVEVTESTVMENIAVV
FT                   SQQLSQLKAGGIRISLDDFGTGYSSFAYLAQLPIDTLKIDKSFILALFKDNSNRHIVEA
FT                   ISNLAHALGMNVTAEGVEEAQHYDFLLENNIDTLQGYHLCRPLPKDEILNNMQKILPVL
FT                   REYTRQ"
     MQTEAPLYDV LNYLPDGIIM LDERGVILFA NDAFSEMVGY KSDLLLGLNM LSLLADITVF        60
     TECIAKVMKE GQSLDAETDF LHRDGHIVQA VKSVRMIRHN DHTRFFVNVR NLTDLIQFNK       120
     ELRASKELIE LQAAELSFLL NSKHQEIEDI LSSIDEVIWY IHNQTLSLQY VNKAVETIFG       180
     FTKETFLSDT TLWQQQIHPE DRSLVQMFFE TLAPGQSQEI RFRILHCDGE VRWLNSRIHN       240
     HPKLNLFIGI TSDITCSKAQ SEEIAFLAYH DPLTHLPNRA KLKLQLENRF EHAPNSPFAL       300
     MFLDLDNFKN INDTMGHKIG DKILIEVSRR IRETVGKYDF YARFGGDEFV ILLQDADSAS       360
     IDLTAQKLIQ VFKEPCTLNE TEFFLSASIG IVLYPDDALN GDDLIKHADT AMYEAKKKGK       420
     NQFAYYHTSM ERAIHHFMYI ESLIREGLTQ NLFELYFQPL IDSKTLRMEG YEALLRLKHP       480
     HKGFIPPDTI IPVAEANGDI HLIGDKVLSQ ACDFIDALRA LQDEPFFVAI NVSAKQLQRN       540
     KFVQELFDYL ALRSIPSSYL KVEVTESTVM ENIAVVSQQL SQLKAGGIRI SLDDFGTGYS       600
     SFAYLAQLPI DTLKIDKSFI LALFKDNSNR HIVEAISNLA HALGMNVTAE GVEEAQHYDF       660
     LLENNIDTLQ GYHLCRPLPK DEILNNMQKI LPVLREYTRQ                             700
//

If you have problems or comments...

PBIL Back to PBIL home page