(data stored in ACNUC7421 zone)

EMBL: CP002355.PE394

CP002355.PE394       Location/Qualifiers
FT   CDS             391022..392626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0395"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0488 ATPase components of ABC transporter
FT                   with duplicated ATPase domains; InterPro IPR003439:
FT                   IPR003593; KEGG: tdn:Suden_1507 ABC transporter-related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33062"
FT                   /db_xref="GOA:E4TZ63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ63"
FT                   /protein_id="ADR33062.1"
FT                   /translation="MVQVTKLTMRFGSRVLFEGINLKLDRNKRYGLIGANGAGKTTFLK
FT                   ILSGEIKEYEGDISIEPGLKVGVLGQNQFAFEDFTIADAVLWGNKRLYDAIKEKEHLYA
FT                   TGDFEDEAVNNRLADLEMICVEEDPTYEYDVQIAKILENVGIPAEHHHDLMSTLPSSEK
FT                   FKVLLAQVLYPKPDVLFLDEPTNNLDIDTIGWLEHELQRHEGTMVVISHDRHFINAVVT
FT                   NILDVDFQKIREFTGNYDDWYLASTVMANQAQLERDKKLKEKEQLEAFVRRFSANASKA
FT                   KQATSRQKQLDKLTIDDIKPSSRRDPSIVFKAKRQMGDEALDVIDVSHSYGDLNVLHDI
FT                   NLKIVPGEKIAVIGGNGVGKSTLLKIIMEEIKPTSGSVKWGATIEPTYFPQDTADRIKG
FT                   TETLYDWLRAFDPKREISEIRNCLGRMLFNGEQQEKSIEKISGGEKHRMMLSKMMLEGG
FT                   NFLVLDEPTNHLDLEAIIALGEALYEFEGNVICVSHDRELLDAFAGRIIELHADGSYID
FT                   FKGTYEEFAEAKASGSL"
     MVQVTKLTMR FGSRVLFEGI NLKLDRNKRY GLIGANGAGK TTFLKILSGE IKEYEGDISI        60
     EPGLKVGVLG QNQFAFEDFT IADAVLWGNK RLYDAIKEKE HLYATGDFED EAVNNRLADL       120
     EMICVEEDPT YEYDVQIAKI LENVGIPAEH HHDLMSTLPS SEKFKVLLAQ VLYPKPDVLF       180
     LDEPTNNLDI DTIGWLEHEL QRHEGTMVVI SHDRHFINAV VTNILDVDFQ KIREFTGNYD       240
     DWYLASTVMA NQAQLERDKK LKEKEQLEAF VRRFSANASK AKQATSRQKQ LDKLTIDDIK       300
     PSSRRDPSIV FKAKRQMGDE ALDVIDVSHS YGDLNVLHDI NLKIVPGEKI AVIGGNGVGK       360
     STLLKIIMEE IKPTSGSVKW GATIEPTYFP QDTADRIKGT ETLYDWLRAF DPKREISEIR       420
     NCLGRMLFNG EQQEKSIEKI SGGEKHRMML SKMMLEGGNF LVLDEPTNHL DLEAIIALGE       480
     ALYEFEGNVI CVSHDRELLD AFAGRIIELH ADGSYIDFKG TYEEFAEAKA SGSL             534
//

If you have problems or comments...

PBIL Back to PBIL home page