(data stored in ACNUC7421 zone)

EMBL: CP002355.PE395

CP002355.PE395       Location/Qualifiers
FT   CDS             392651..393484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1508 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ64"
FT                   /protein_id="ADR33063.1"
FT                   /translation="MDSYKNFVGLGVAGNFALHLEQAGESADFKDVVSEDPNGPKGVFP
FT                   FYIPGREGQLGVYPLSCDTIILPKEACNVQPEPEVALICELTYDAEGNVSAITPKFFGA
FT                   YNDCSLRKEGAAKISHKKNWGEGTKGLSRTLIPIDSFEQGGIMDRYRIASFVRREGMMM
FT                   RYGEDVELTGYSYFHGKLIEWLKNQLNTQEDFGPLEPIKNYLMEAGSPAQAIISIGATR
FT                   YTHFGETNFLQDGDEVIVVVYDNDKYCMNPILSMANRGALEGEGISALIQKVVRG"
     MDSYKNFVGL GVAGNFALHL EQAGESADFK DVVSEDPNGP KGVFPFYIPG REGQLGVYPL        60
     SCDTIILPKE ACNVQPEPEV ALICELTYDA EGNVSAITPK FFGAYNDCSL RKEGAAKISH       120
     KKNWGEGTKG LSRTLIPIDS FEQGGIMDRY RIASFVRREG MMMRYGEDVE LTGYSYFHGK       180
     LIEWLKNQLN TQEDFGPLEP IKNYLMEAGS PAQAIISIGA TRYTHFGETN FLQDGDEVIV       240
     VVYDNDKYCM NPILSMANRG ALEGEGISAL IQKVVRG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page