(data stored in ACNUC7421 zone)

EMBL: CP002355.PE396

CP002355.PE396       Location/Qualifiers
FT   CDS             393477..393683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0397"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="COGs: COG4728 conserved hypothetical protein;
FT                   InterPro IPR012868; KEGG: pag:PLES_20501 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1653; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1653)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33064"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ65"
FT                   /protein_id="ADR33064.1"
FT                   /translation="MVKSGLYRHYKGKYYEVIGVAKHSETEELLVVYRPLYGEQGLWVR
FT                   PLEMFDEILPNGTKRFTYSGEVK"
     MVKSGLYRHY KGKYYEVIGV AKHSETEELL VVYRPLYGEQ GLWVRPLEMF DEILPNGTKR        60
     FTYSGEVK                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page