(data stored in ACNUC7421 zone)

EMBL: CP002355.PE398

CP002355.PE398       Location/Qualifiers
FT   CDS             complement(394013..395221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0399"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: tdn:Suden_1511 diguanylate cyclase; PFAM: GGDEF
FT                   domain containing protein; SMART: GGDEF domain containing
FT                   protein; SPTR: Diguanylate cyclase; TIGRFAM: diguanylate
FT                   cyclase; PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33066"
FT                   /db_xref="GOA:E4TZ67"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ67"
FT                   /protein_id="ADR33066.1"
FT                   /translation="MKALKLKTKLLYLLLLVGFGLVVIGLIGYINIQNIKRNMDTLYFG
FT                   SLIPLNELNTITATYHNDLGSSVYRWSHQLLSDEQAATNILQGLDRINHLWTSYLSHDK
FT                   HPEEMAYINYTEAQIRSIENYFMQVHSTVSDPSRSHPISLMTMDENIQSIQKTIAQLIT
FT                   YEYENAKYEHAMLLAQYENALMQLILFLGVILALVMGLAWVIFSRIEIQQQQLIASSET
FT                   LKHLNLKLEQASYTDSLTSLFNRRYFNIVYDREFKRALRSNKPFVFMMLDIDFFKQYND
FT                   TYGHIQGDVALQTVAKILKSTLQRPGDYPFRLGGEEFGIILCDIDCKNAHIMGEKVRAA
FT                   IDSLKIEHKGSKILPTLSVSIGGICITPTLDMSDDALIHAADTNLYAAKERGRNQVVFG
FT                   NKL"
     MKALKLKTKL LYLLLLVGFG LVVIGLIGYI NIQNIKRNMD TLYFGSLIPL NELNTITATY        60
     HNDLGSSVYR WSHQLLSDEQ AATNILQGLD RINHLWTSYL SHDKHPEEMA YINYTEAQIR       120
     SIENYFMQVH STVSDPSRSH PISLMTMDEN IQSIQKTIAQ LITYEYENAK YEHAMLLAQY       180
     ENALMQLILF LGVILALVMG LAWVIFSRIE IQQQQLIASS ETLKHLNLKL EQASYTDSLT       240
     SLFNRRYFNI VYDREFKRAL RSNKPFVFMM LDIDFFKQYN DTYGHIQGDV ALQTVAKILK       300
     STLQRPGDYP FRLGGEEFGI ILCDIDCKNA HIMGEKVRAA IDSLKIEHKG SKILPTLSVS       360
     IGGICITPTL DMSDDALIHA ADTNLYAAKE RGRNQVVFGN KL                          402
//

If you have problems or comments...

PBIL Back to PBIL home page