(data stored in ACNUC7421 zone)

EMBL: CP002355.PE399

CP002355.PE399       Location/Qualifiers
FT   CDS             395316..395630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO0669 ATP phosphoribosyltransferase
FT                   catalytic subunit; SPTR: ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33067"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ68"
FT                   /protein_id="ADR33067.1"
FT                   /translation="MAKRLIKDERIKTIIHNIAEDFRFSHETGDYALLFYKADTEGAVR
FT                   GADIEAMIEYLSTGLSELQDNIQWRREFLSENPGVDEIRMLENLGVIEKEYIDLLEFLR
FT                   "
     MAKRLIKDER IKTIIHNIAE DFRFSHETGD YALLFYKADT EGAVRGADIE AMIEYLSTGL        60
     SELQDNIQWR REFLSENPGV DEIRMLENLG VIEKEYIDLL EFLR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page