(data stored in ACNUC7421 zone)

EMBL: CP002355.PE4

CP002355.PE4         Location/Qualifiers
FT   CDS             5216..6619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0004"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160; KEGG: nis:NIS_0004 hypothetical protein; PFAM:
FT                   EAL domain protein; GGDEF domain containing protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; SPTR:
FT                   Diguanylate cyclase/phosphodiesterase, putative; PFAM: EAL
FT                   domain; GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32672"
FT                   /db_xref="GOA:E4TW56"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW56"
FT                   /protein_id="ADR32672.1"
FT                   /translation="MTYTEQKEREHRFALALRMGLPIFFLSSVTLFALFSQTYTSLASL
FT                   IVLSISLLGIMIYFIFYLIYQSAHETITDPTTYAFTSEYFFKLGSKALLKNTQTVMMIS
FT                   VENLWSINERYGIKNGDKALQNTVKKLDRFFRDKGYDKLPIGRYKGGDFLAFLPGEKEQ
FT                   YRVLIELFLSKYENHIDNEIEIRVGIVMVDSRLSNNMELLTSRLYELHNDRLTAEKEEF
FT                   YSINELEHEILEALEHKRISIGFWPVCCDDDMFDTSVKLIDSEGRLIHQSRYIPVLNRL
FT                   NKMRFLESDVLEKIGALCNEKNQNIVLTISPVTLRNPHFFEHALTLFERYPKARNKITL
FT                   LFEEREYCHQLERFSQQIAHYRKAGYKIALDRLGGYQTTLLYLKELEIDIVRFDSLYSR
FT                   NIKKAGYQNIIQGLNLSAHLCGAKTWMSMIEDSNSDQLCQSLKINYRQGNYLGKILTLD
FT                   DITKKETNI"
     MTYTEQKERE HRFALALRMG LPIFFLSSVT LFALFSQTYT SLASLIVLSI SLLGIMIYFI        60
     FYLIYQSAHE TITDPTTYAF TSEYFFKLGS KALLKNTQTV MMISVENLWS INERYGIKNG       120
     DKALQNTVKK LDRFFRDKGY DKLPIGRYKG GDFLAFLPGE KEQYRVLIEL FLSKYENHID       180
     NEIEIRVGIV MVDSRLSNNM ELLTSRLYEL HNDRLTAEKE EFYSINELEH EILEALEHKR       240
     ISIGFWPVCC DDDMFDTSVK LIDSEGRLIH QSRYIPVLNR LNKMRFLESD VLEKIGALCN       300
     EKNQNIVLTI SPVTLRNPHF FEHALTLFER YPKARNKITL LFEEREYCHQ LERFSQQIAH       360
     YRKAGYKIAL DRLGGYQTTL LYLKELEIDI VRFDSLYSRN IKKAGYQNII QGLNLSAHLC       420
     GAKTWMSMIE DSNSDQLCQS LKINYRQGNY LGKILTLDDI TKKETNI                     467
//

If you have problems or comments...

PBIL Back to PBIL home page