(data stored in ACNUC7421 zone)

EMBL: CP002355.PE401

CP002355.PE401       Location/Qualifiers
FT   CDS             396194..396556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1497 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33069"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI1"
FT                   /protein_id="ADR33069.1"
FT                   /translation="MNASKEENSKRLRYIRLLGRFISGIISWLSKAQSPTKEQYDQKVD
FT                   MNFRFLEKNEAVKLYKDEYTELEALGQKILDFRASENDIETIKEELFYAQNQLEKRINA
FT                   RRYKKSKHDNHTTDGW"
     MNASKEENSK RLRYIRLLGR FISGIISWLS KAQSPTKEQY DQKVDMNFRF LEKNEAVKLY        60
     KDEYTELEAL GQKILDFRAS ENDIETIKEE LFYAQNQLEK RINARRYKKS KHDNHTTDGW       120
//

If you have problems or comments...

PBIL Back to PBIL home page