(data stored in ACNUC7421 zone)

EMBL: CP002355.PE402

CP002355.PE402       Location/Qualifiers
FT   CDS             complement(396557..397114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0403"
FT                   /product="protein of unknown function DUF204"
FT                   /note="COGs: COG1971 membrane protein; InterPro IPR003810;
FT                   KEGG: ccv:CCV52592_0090 membrane protein; PFAM: protein of
FT                   unknown function DUF204; SPTR: Putative membrane protein;
FT                   PFAM: Domain of unknown function DUF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33070"
FT                   /db_xref="GOA:E4TZI2"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI2"
FT                   /protein_id="ADR33070.1"
FT                   /translation="MNETLLILAVALAMDSVAVSIAIGSKYKRLLLSKVLFVAAVFGFF
FT                   QGIMPLAGYFIGISFAQYVQDYDHWIAFALLTALGGKMLYEAYKNEFDEEVTDLSTKTL
FT                   ITLGIATSIDAMAIGVTFAFLQTDIYTAAGVIALVTFLLCIAAVYIGKKLGSLLESKAE
FT                   MLGGLILIGLGFKILLEHLGVI"
     MNETLLILAV ALAMDSVAVS IAIGSKYKRL LLSKVLFVAA VFGFFQGIMP LAGYFIGISF        60
     AQYVQDYDHW IAFALLTALG GKMLYEAYKN EFDEEVTDLS TKTLITLGIA TSIDAMAIGV       120
     TFAFLQTDIY TAAGVIALVT FLLCIAAVYI GKKLGSLLES KAEMLGGLIL IGLGFKILLE       180
     HLGVI                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page