(data stored in ACNUC7421 zone)

EMBL: CP002355.PE403

CP002355.PE403       Location/Qualifiers
FT   CDS             complement(397190..398254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0404"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   nis:NIS_0906 hypothetical protein; PFAM: permease; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33071"
FT                   /db_xref="GOA:E4TZI3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI3"
FT                   /protein_id="ADR33071.1"
FT                   /translation="MNLIWEAFWDLSVAMGIYILFGLLAAGVLHQLIREEWIQKHLGSD
FT                   THGSVYKAALFGTPLPLCSCSVIPFAASLRRNGASKGATLSFLISTPITGIDSILATFG
FT                   MFGWVFTFYRVFTSVILAITAGMLMNIFDPKEVAKKGVAFSATPPNAPSPIIQSAKEEK
FT                   KPPFSVSGVFQYGLVTLLGSFSKPLLFGLLLGAFITAAIPSNLQELFNDNRILGYLLAV
FT                   AIAAPMYVCATESLPIAASLIIAGVSPGAAFIFLSAGPATNTVTMGAVKSMLGTRALVI
FT                   YLSVIAIGSITFGALVDIVFDTLSINMGINLHEHRGIVEEAAAVLMLGLIGWHLIRGLF
FT                   QQKEKGCNGGSCCS"
     MNLIWEAFWD LSVAMGIYIL FGLLAAGVLH QLIREEWIQK HLGSDTHGSV YKAALFGTPL        60
     PLCSCSVIPF AASLRRNGAS KGATLSFLIS TPITGIDSIL ATFGMFGWVF TFYRVFTSVI       120
     LAITAGMLMN IFDPKEVAKK GVAFSATPPN APSPIIQSAK EEKKPPFSVS GVFQYGLVTL       180
     LGSFSKPLLF GLLLGAFITA AIPSNLQELF NDNRILGYLL AVAIAAPMYV CATESLPIAA       240
     SLIIAGVSPG AAFIFLSAGP ATNTVTMGAV KSMLGTRALV IYLSVIAIGS ITFGALVDIV       300
     FDTLSINMGI NLHEHRGIVE EAAAVLMLGL IGWHLIRGLF QQKEKGCNGG SCCS             354
//

If you have problems or comments...

PBIL Back to PBIL home page