(data stored in ACNUC7421 zone)

EMBL: CP002355.PE404

CP002355.PE404       Location/Qualifiers
FT   CDS             complement(398348..399274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0405"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG1230 Co/Zn/Cd efflux system component;
FT                   InterPro IPR002524; KEGG: net:Neut_0043 cation diffusion
FT                   facilitator family transporter; PFAM: cation efflux
FT                   protein; SPTR: Probable metal transporter; TIGRFAM: cation
FT                   diffusion facilitator family transporter; PFAM: Cation
FT                   efflux family; TIGRFAM: cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33072"
FT                   /db_xref="GOA:E4TZI4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI4"
FT                   /protein_id="ADR33072.1"
FT                   /translation="MSTSAEKWYHSHIFDEGNPLAERNTRIAVALTAFMMVAEIIGGWA
FT                   YNSMALLADGWHMGTHALALGLSVMAYGAARRYENDKRFAFGTWKIEVLGGYTSAIFLV
FT                   GVAALMFYESAQRLISPTPIHYGEAIQIAVIGLVVNLICAWLLKDGHHHDHDHHHGHDH
FT                   SHDHHHDLNLRSAYMHVIADAATSVLAIIALFCGMLWGAAWLDPIMGIVGAGLVAVWAY
FT                   GLLRDSGRILLDAEMDAPVVDEIYDVIEASPIKATITDLHVWRVGKGKYSCILSLHTTE
FT                   EVSPDFFKQQLSIHEELVHITVEVNQA"
     MSTSAEKWYH SHIFDEGNPL AERNTRIAVA LTAFMMVAEI IGGWAYNSMA LLADGWHMGT        60
     HALALGLSVM AYGAARRYEN DKRFAFGTWK IEVLGGYTSA IFLVGVAALM FYESAQRLIS       120
     PTPIHYGEAI QIAVIGLVVN LICAWLLKDG HHHDHDHHHG HDHSHDHHHD LNLRSAYMHV       180
     IADAATSVLA IIALFCGMLW GAAWLDPIMG IVGAGLVAVW AYGLLRDSGR ILLDAEMDAP       240
     VVDEIYDVIE ASPIKATITD LHVWRVGKGK YSCILSLHTT EEVSPDFFKQ QLSIHEELVH       300
     ITVEVNQA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page