(data stored in ACNUC7421 zone)

EMBL: CP002355.PE405

CP002355.PE405       Location/Qualifiers
FT   CDS             399351..399623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0406"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein;
FT                   InterPro IPR003735; KEGG: pag:PLES_38841 hypothetical
FT                   protein; PFAM: protein of unknown function DUF156; SPTR:
FT                   Protein of hypothetical function DUF156; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33073"
FT                   /db_xref="GOA:E4TZI5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI5"
FT                   /protein_id="ADR33073.1"
FT                   /translation="MAHTIHSKKQLLTRVRRIKGQAEALERALDDEKECSAVLQQIAAI
FT                   RGAINGLMSEVMEGYIREHLSPDVPEQQRNEDLEKLVSVIRSYLK"
     MAHTIHSKKQ LLTRVRRIKG QAEALERALD DEKECSAVLQ QIAAIRGAIN GLMSEVMEGY        60
     IREHLSPDVP EQQRNEDLEK LVSVIRSYLK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page