(data stored in ACNUC7421 zone)

EMBL: CP002355.PE408

CP002355.PE408       Location/Qualifiers
FT   CDS             400772..402745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0409"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR000160:
FT                   IPR003660: IPR001633; KEGG: cbe:Cbei_2527 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; histidine kinase HAMP region
FT                   domain protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; SPTR: Ggdef family protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain; GGDEF domain;
FT                   TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33076"
FT                   /db_xref="GOA:E4TZI8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI8"
FT                   /protein_id="ADR33076.1"
FT                   /translation="MSHKTTYTKIAAKIIFITMLVTLVATYIYGEYMKRDAITNLAHVD
FT                   AKKTSMLVFEALYSAMQRGWNKNDLEEIISRLNRVDSHMKVNVYRSEVVADLFGEIEKD
FT                   KVARESNTEIKKAIRGEEVLNISDKELIEYYYPVIAKENCLKCHVNASSGDVLGVIDIS
FT                   YPVENLKVPLTDMINFFIIFIIVFSIIVYLSIFIELNQYLIKPIKNFSNLIKNITASQD
FT                   MRKRIELNENIEEIDSIKDVFNSMLDSIEHQFYFDTLTGLENRRRLTEKLEERHSVFLM
FT                   IINIDSFQEINDLYGEPAGDLILKEFAQYLKEIMPKEEGLYRLHSDEFAHICTSGMDLN
FT                   EFRNFAALISEKISQKSFNIDERSEVSLSATIGVSYGSELLLVNADIALKLAKKTKKNF
FT                   LIYDNTMAMTKEYEKNFDWTKRLKKAIEEDKIVPLFQPIVDTKTQVIVKYEALMRMVDD
FT                   QGFYIAPVHFLELAKKNKLYHQLTKIMIQKTFEKFQSLTYFVSINISVEDILNKEINHF
FT                   IVKTLEESGIGHQIVFEIIESEGIENFDQVLEFINEVKQYGAKISIDDFGTGYSNFEYL
FT                   MKLKVDYIKIDGSMIKNIDSDKNSQMITTSIVSFAKNMNIKTVAEFVHSKNVFEKINEL
FT                   GVDYSQGYYFGEPTELVTPSSP"
     MSHKTTYTKI AAKIIFITML VTLVATYIYG EYMKRDAITN LAHVDAKKTS MLVFEALYSA        60
     MQRGWNKNDL EEIISRLNRV DSHMKVNVYR SEVVADLFGE IEKDKVARES NTEIKKAIRG       120
     EEVLNISDKE LIEYYYPVIA KENCLKCHVN ASSGDVLGVI DISYPVENLK VPLTDMINFF       180
     IIFIIVFSII VYLSIFIELN QYLIKPIKNF SNLIKNITAS QDMRKRIELN ENIEEIDSIK       240
     DVFNSMLDSI EHQFYFDTLT GLENRRRLTE KLEERHSVFL MIINIDSFQE INDLYGEPAG       300
     DLILKEFAQY LKEIMPKEEG LYRLHSDEFA HICTSGMDLN EFRNFAALIS EKISQKSFNI       360
     DERSEVSLSA TIGVSYGSEL LLVNADIALK LAKKTKKNFL IYDNTMAMTK EYEKNFDWTK       420
     RLKKAIEEDK IVPLFQPIVD TKTQVIVKYE ALMRMVDDQG FYIAPVHFLE LAKKNKLYHQ       480
     LTKIMIQKTF EKFQSLTYFV SINISVEDIL NKEINHFIVK TLEESGIGHQ IVFEIIESEG       540
     IENFDQVLEF INEVKQYGAK ISIDDFGTGY SNFEYLMKLK VDYIKIDGSM IKNIDSDKNS       600
     QMITTSIVSF AKNMNIKTVA EFVHSKNVFE KINELGVDYS QGYYFGEPTE LVTPSSP          657
//

If you have problems or comments...

PBIL Back to PBIL home page