(data stored in ACNUC7421 zone)

EMBL: CP002355.PE41

CP002355.PE41        Location/Qualifiers
FT   CDS             41300..41830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0041"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="COGs: COG3545 esterase of the alpha/beta hydrolase
FT                   fold; InterPro IPR010662; KEGG: tdn:Suden_0144 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1234; SPTR:
FT                   Putative uncharacterized protein; PFAM: Alpha/Beta
FT                   hydrolase family of unknown function (DUF1234)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32709"
FT                   /db_xref="GOA:E4TW93"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW93"
FT                   /protein_id="ADR32709.1"
FT                   /translation="MLKVLILHGWGGSDDPHWQAWLAGEIAKDYGTVSFPLLDNPHFPS
FT                   KNRWMKQIKSLLNDFRPDIVICHSLANIAWFHLCNEGEISPVKRLLLVAPPHLTCEIET
FT                   LKTFFPLEAPKALFAEEVLLVTSTDDPYMSTQEAAELQKALGVEMKVIENGGHINTASG
FT                   YGEWPWVKEWVLQ"
     MLKVLILHGW GGSDDPHWQA WLAGEIAKDY GTVSFPLLDN PHFPSKNRWM KQIKSLLNDF        60
     RPDIVICHSL ANIAWFHLCN EGEISPVKRL LLVAPPHLTC EIETLKTFFP LEAPKALFAE       120
     EVLLVTSTDD PYMSTQEAAE LQKALGVEMK VIENGGHINT ASGYGEWPWV KEWVLQ           176
//

If you have problems or comments...

PBIL Back to PBIL home page