(data stored in ACNUC7421 zone)

EMBL: CP002355.PE410

CP002355.PE410       Location/Qualifiers
FT   CDS             complement(402957..403196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phu:Phum_PHUM424130 zinc finger and cchc
FT                   domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33078"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ0"
FT                   /protein_id="ADR33078.1"
FT                   /translation="MSLEITEWQRIQHTLNNIVNLTSIEALIMAHKAKITVNEMLKCQT
FT                   ISELKKIPIEHVFKKMAHFKESSAYLIYKQEFTY"
     MSLEITEWQR IQHTLNNIVN LTSIEALIMA HKAKITVNEM LKCQTISELK KIPIEHVFKK        60
     MAHFKESSAY LIYKQEFTY                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page