(data stored in ACNUC7421 zone)

EMBL: CP002355.PE412

CP002355.PE412       Location/Qualifiers
FT   CDS             complement(404822..405304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1827 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33080"
FT                   /db_xref="GOA:E4TZJ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ2"
FT                   /protein_id="ADR33080.1"
FT                   /translation="MIIPLSSETLSDFFTFFDFTCESDALQAFIGLLRETASHHQNIIH
FT                   AGYADQTPFGFVSLKITNDVDNIPGLLIEFLYIKPEYRQKMLGGTPRYSFSMLDDVIML
FT                   AFELQKIVAINHIFLIPVDENKRAMYLEYGFENIPGSGKNPFEDFMVFNLLSEEII"
     MIIPLSSETL SDFFTFFDFT CESDALQAFI GLLRETASHH QNIIHAGYAD QTPFGFVSLK        60
     ITNDVDNIPG LLIEFLYIKP EYRQKMLGGT PRYSFSMLDD VIMLAFELQK IVAINHIFLI       120
     PVDENKRAMY LEYGFENIPG SGKNPFEDFM VFNLLSEEII                             160
//

If you have problems or comments...

PBIL Back to PBIL home page