(data stored in ACNUC7421 zone)

EMBL: CP002355.PE413

CP002355.PE413       Location/Qualifiers
FT   CDS             complement(405312..405455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33081"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ3"
FT                   /protein_id="ADR33081.1"
FT                   /translation="MSYVIRDGKVETAKPIKNLNEEQKKVLKVTTAKQADKIKALKAKL
FT                   AS"
     MSYVIRDGKV ETAKPIKNLN EEQKKVLKVT TAKQADKIKA LKAKLAS                      47
//

If you have problems or comments...

PBIL Back to PBIL home page