(data stored in ACNUC7421 zone)

EMBL: CP002355.PE414

CP002355.PE414       Location/Qualifiers
FT   CDS             405885..406277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0692 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33082"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ4"
FT                   /protein_id="ADR33082.1"
FT                   /translation="MKKLLILICMMVLNLSAHSIHNDDQFKAAVASMGADNKLVLMIYT
FT                   TDDCPECAYMKQKVFHDKGVEDYMNRHFVVIEKNVHKNKLPDGYDFFGIPTMFFIDKAG
FT                   NRKETVVGSKRAQPFLAELHRIRGMK"
     MKKLLILICM MVLNLSAHSI HNDDQFKAAV ASMGADNKLV LMIYTTDDCP ECAYMKQKVF        60
     HDKGVEDYMN RHFVVIEKNV HKNKLPDGYD FFGIPTMFFI DKAGNRKETV VGSKRAQPFL       120
     AELHRIRGMK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page