(data stored in ACNUC7421 zone)

EMBL: CP002355.PE415

CP002355.PE415       Location/Qualifiers
FT   CDS             406274..406870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0416"
FT                   /product="pentapeptide repeat protein"
FT                   /note="COGs: COG1357 Uncharacterized low-complexity
FT                   protein; InterPro IPR001646; KEGG: tbd:Tbd_0916
FT                   hypothetical protein; PFAM: pentapeptide repeat protein;
FT                   SPTR: Pentapeptide repeat protein; PFAM: Pentapeptide
FT                   repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33083"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ5"
FT                   /protein_id="ADR33083.1"
FT                   /translation="MKLAWLAFWIGVSLSAYDAAHLKKALEDKECIGCDLRGADLSQND
FT                   FSGGDFHGSDLSEADLHESIFEMGDLSDCNLSGANAENALFWKGTMERADLTRIHARGA
FT                   NFKGVHLNRSRLNSADLRGTKSWKADFTDASFSKTDFTDAELGDAKFIRNDLRTVKMKR
FT                   ALLWQTRFSDTVLTKAQCAHAKKEEAILDANVTCR"
     MKLAWLAFWI GVSLSAYDAA HLKKALEDKE CIGCDLRGAD LSQNDFSGGD FHGSDLSEAD        60
     LHESIFEMGD LSDCNLSGAN AENALFWKGT MERADLTRIH ARGANFKGVH LNRSRLNSAD       120
     LRGTKSWKAD FTDASFSKTD FTDAELGDAK FIRNDLRTVK MKRALLWQTR FSDTVLTKAQ       180
     CAHAKKEEAI LDANVTCR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page