(data stored in ACNUC7421 zone)

EMBL: CP002355.PE416

CP002355.PE416       Location/Qualifiers
FT   CDS             complement(406867..408015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0417"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="COGs: COG2059 Chromate transport protein ChrA;
FT                   InterPro IPR014047: IPR003370; KEGG: vsa:VSAL_I0672
FT                   putative chromate transporter; PFAM: Chromate transporter;
FT                   SPTR: Chromate transport protein; TIGRFAM: chromate
FT                   transporter, chromate ion transporter (CHR) family; PFAM:
FT                   Chromate transporter; TIGRFAM: chromate transporter,
FT                   chromate ion transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33084"
FT                   /db_xref="GOA:E4TZJ6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ6"
FT                   /protein_id="ADR33084.1"
FT                   /translation="MKIWELFWRFLLLGLVSFGGPAAHIGYFRTTFVDKLRWLDNASYA
FT                   RLVALSQFLPGPGSSQVGFAIGIERAGLLGGIAAFIGFTIPSFIFMATLAIVPFEPTPI
FT                   FTGMIHGLKLFAVIVVADAVLSMYRSFCTSTAASAIAIASAASLWLFPSLSTQMILLII
FT                   SAVIGLMFLHIPIATSAVPIRISYIPLILFLALFILVPFFVDVSKWIALFNTFFQSGAL
FT                   VFGGGHVVLPLLQHALGDSITTERFLFGYAAAQAVPGPMFSLAAFLGTDLSPSSPLLGA
FT                   LVATLSIFLPGFLLLLGLYRGWEILAQRPRIAAVAAGLNAAVVGILLAALYNPVFTSGV
FT                   TSTIDMALVVTGFFLLRMLKIPVVGLLPIFALSGVIISVKFV"
     MKIWELFWRF LLLGLVSFGG PAAHIGYFRT TFVDKLRWLD NASYARLVAL SQFLPGPGSS        60
     QVGFAIGIER AGLLGGIAAF IGFTIPSFIF MATLAIVPFE PTPIFTGMIH GLKLFAVIVV       120
     ADAVLSMYRS FCTSTAASAI AIASAASLWL FPSLSTQMIL LIISAVIGLM FLHIPIATSA       180
     VPIRISYIPL ILFLALFILV PFFVDVSKWI ALFNTFFQSG ALVFGGGHVV LPLLQHALGD       240
     SITTERFLFG YAAAQAVPGP MFSLAAFLGT DLSPSSPLLG ALVATLSIFL PGFLLLLGLY       300
     RGWEILAQRP RIAAVAAGLN AAVVGILLAA LYNPVFTSGV TSTIDMALVV TGFFLLRMLK       360
     IPVVGLLPIF ALSGVIISVK FV                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page