(data stored in ACNUC7421 zone)

EMBL: CP002355.PE417

CP002355.PE417       Location/Qualifiers
FT   CDS             complement(408035..408475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr6985 hypothetical protein; SPTR:
FT                   Blr6985 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33085"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ7"
FT                   /protein_id="ADR33085.1"
FT                   /translation="MKRIGISVLILIAQLHANEPQSYTPGLGDMMGAVQIRHAKLWFAG
FT                   QNQNWKLATYELDEIKEGLEDAAVYHPIFKGKPIAKMMKISIAPALDQVEESIKQKNSS
FT                   QFIKAFETLSNACTSCHKNSGYGFIVIERPSTPPFSNQRFKP"
     MKRIGISVLI LIAQLHANEP QSYTPGLGDM MGAVQIRHAK LWFAGQNQNW KLATYELDEI        60
     KEGLEDAAVY HPIFKGKPIA KMMKISIAPA LDQVEESIKQ KNSSQFIKAF ETLSNACTSC       120
     HKNSGYGFIV IERPSTPPFS NQRFKP                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page