(data stored in ACNUC7421 zone)

EMBL: CP002355.PE419

CP002355.PE419       Location/Qualifiers
FT   CDS             409217..410260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0420"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661: IPR003594: IPR004358: IPR005467; KEGG:
FT                   ant:Arnit_2163 integral membrane sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SPTR: Integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33087"
FT                   /db_xref="GOA:E4TZJ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ9"
FT                   /protein_id="ADR33087.1"
FT                   /translation="MNYREKESFIKSFSLFFVALFSMGAIALWLYHEEQQRFYQLQLLT
FT                   EMDAFSYVLQGEEFAYAIMNLDKDQPIHELIVKDTEVYALFPWVRNPDNEMVKVTYPHQ
FT                   EYLKYMDAESRKIWMLFLSLGFITVLLSAFFARYTLTPMRRSLLLMENFLKDIIHDLNT
FT                   PVSSILLNSQLLKRKYTDEEIDRIYISGQTITGLYKNLEVLYRQLPIEQDEVRLDTFLH
FT                   ERIRYFQTLYPSLSLTLEGEREMSISINRDILMRIVDNLLSNACKYNRSNGQVTVRYDQ
FT                   TSIEIIDTGIGIKHLDKVFHRFYKETERGLGMGLHIVKTLADRVGIAIEIESQKGIGTH
FT                   VTIHFLR"
     MNYREKESFI KSFSLFFVAL FSMGAIALWL YHEEQQRFYQ LQLLTEMDAF SYVLQGEEFA        60
     YAIMNLDKDQ PIHELIVKDT EVYALFPWVR NPDNEMVKVT YPHQEYLKYM DAESRKIWML       120
     FLSLGFITVL LSAFFARYTL TPMRRSLLLM ENFLKDIIHD LNTPVSSILL NSQLLKRKYT       180
     DEEIDRIYIS GQTITGLYKN LEVLYRQLPI EQDEVRLDTF LHERIRYFQT LYPSLSLTLE       240
     GEREMSISIN RDILMRIVDN LLSNACKYNR SNGQVTVRYD QTSIEIIDTG IGIKHLDKVF       300
     HRFYKETERG LGMGLHIVKT LADRVGIAIE IESQKGIGTH VTIHFLR                     347
//

If you have problems or comments...

PBIL Back to PBIL home page