(data stored in ACNUC7421 zone)

EMBL: CP002355.PE420

CP002355.PE420       Location/Qualifiers
FT   CDS             410324..411550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0421"
FT                   /product="sulfite dehydrogenase (cytochrome) subunit SorA
FT                   apoprotein"
FT                   /EC_number="1.8.2.1"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572:
FT                   IPR005066: IPR008335: IPR017909; KEGG: sun:SUN_1104
FT                   sulfite:cytochrome c oxidoreductase subunit A; PFAM:
FT                   oxidoreductase molybdopterin binding; Mo-co oxidoreductase
FT                   dimerisation domain; SPTR: Sulfite oxidase, putative; PFAM:
FT                   Mo-co oxidoreductase dimerisation domain; Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33088"
FT                   /db_xref="GOA:E4TZK0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK0"
FT                   /protein_id="ADR33088.1"
FT                   /translation="MKKINRRDFLGAGLILGASTLLGQETSKNLLPQGEEFIPPVIAFP
FT                   EKMPMKTISDRPPLLGSARGRELFTQAITPNNQFFVRWHLPDIPTYINLNEFRLEVKGS
FT                   VSTPLSLSIDDLKSKFEPAEVTAVLQCGGNSRKYYAVTGQATHGVQWDHDAMGCAIWRG
FT                   VRLKDILNRAGVKSSAKWIGLNGLEKPAMDETPDFFREMEIEEALEDQIIVAYAMNGED
FT                   LPYLNGFPIRLVIPGHFSDSWVKMLSEVMVMDTYRESFFMDVAYTVPDNDCECVISGND
FT                   FEYKRKPIAAMKVKSVIGYPLPGTAIKKGSRVKIAGVAFDQGKGIKEVMISLDSGKNWS
FT                   AAKLGEDHGKFAFRPWSYEWEPKTKGEYTIMVRAINRIGNIQPMPHEIGWNAGGYQYNA
FT                   VDSVSVQIV"
     MKKINRRDFL GAGLILGAST LLGQETSKNL LPQGEEFIPP VIAFPEKMPM KTISDRPPLL        60
     GSARGRELFT QAITPNNQFF VRWHLPDIPT YINLNEFRLE VKGSVSTPLS LSIDDLKSKF       120
     EPAEVTAVLQ CGGNSRKYYA VTGQATHGVQ WDHDAMGCAI WRGVRLKDIL NRAGVKSSAK       180
     WIGLNGLEKP AMDETPDFFR EMEIEEALED QIIVAYAMNG EDLPYLNGFP IRLVIPGHFS       240
     DSWVKMLSEV MVMDTYRESF FMDVAYTVPD NDCECVISGN DFEYKRKPIA AMKVKSVIGY       300
     PLPGTAIKKG SRVKIAGVAF DQGKGIKEVM ISLDSGKNWS AAKLGEDHGK FAFRPWSYEW       360
     EPKTKGEYTI MVRAINRIGN IQPMPHEIGW NAGGYQYNAV DSVSVQIV                    408
//

If you have problems or comments...

PBIL Back to PBIL home page