(data stored in ACNUC7421 zone)

EMBL: CP002355.PE421

CP002355.PE421       Location/Qualifiers
FT   CDS             411560..411877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0422"
FT                   /product="sulfite:cytochrome c oxidoreductase subunit B"
FT                   /note="KEGG: sun:SUN_1103 sulfite:cytochrome c
FT                   oxidoreductase subunit B; SPTR: Sulfite:cytochrome c
FT                   oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33089"
FT                   /db_xref="GOA:E4TZK1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK1"
FT                   /protein_id="ADR33089.1"
FT                   /translation="MKKIILLSALLISISFAQVAQPIEIPYVDYPMVKGDHDEVAQQYC
FT                   LICHSWGYILNQGKKSRPYWSGTVQKMVNEFKAPISKEEQQTIINYLVKHYGYENSVSG
FT                   H"
     MKKIILLSAL LISISFAQVA QPIEIPYVDY PMVKGDHDEV AQQYCLICHS WGYILNQGKK        60
     SRPYWSGTVQ KMVNEFKAPI SKEEQQTIIN YLVKHYGYEN SVSGH                       105
//

If you have problems or comments...

PBIL Back to PBIL home page