(data stored in ACNUC7421 zone)

EMBL: CP002355.PE422

CP002355.PE422       Location/Qualifiers
FT   CDS             411951..412886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0423"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: tdn:Suden_0648 von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33090"
FT                   /db_xref="GOA:E4TZK2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK2"
FT                   /protein_id="ADR33090.1"
FT                   /translation="MLIGNISAMNIWSFDFAWAFLALPPILYCLYRCKVIPQKRYFPHL
FT                   QFFGNPGKWRNLEWLFKALAVTLMVGALATPVVVDYSDPRNRNGIDIVLSLDGSGSMNA
FT                   SGFSKEEPRLSRFEVVQKIASDFVMKRIEDNVGVVLFGDFAFIATPVTYEKEIVSEMIG
FT                   YLSHGMAGQNTAIGEGIAMGVRALRDSKAKSKVIILLTDGEHNSGSISPKEAVAMVGKE
FT                   HIRLYTIGIGQKGEFDNALLKQLAHDGHGKFFAAANEKELQSVYDEIDMLERSKIKSKQ
FT                   HTFEEHYYQWFGAAALGVLLILMWRRRIGS"
     MLIGNISAMN IWSFDFAWAF LALPPILYCL YRCKVIPQKR YFPHLQFFGN PGKWRNLEWL        60
     FKALAVTLMV GALATPVVVD YSDPRNRNGI DIVLSLDGSG SMNASGFSKE EPRLSRFEVV       120
     QKIASDFVMK RIEDNVGVVL FGDFAFIATP VTYEKEIVSE MIGYLSHGMA GQNTAIGEGI       180
     AMGVRALRDS KAKSKVIILL TDGEHNSGSI SPKEAVAMVG KEHIRLYTIG IGQKGEFDNA       240
     LLKQLAHDGH GKFFAAANEK ELQSVYDEID MLERSKIKSK QHTFEEHYYQ WFGAAALGVL       300
     LILMWRRRIG S                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page