(data stored in ACNUC7421 zone)

EMBL: CP002355.PE423

CP002355.PE423       Location/Qualifiers
FT   CDS             412883..414406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0424"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035: IPR001440: IPR019734: IPR013026;
FT                   KEGG: tdn:Suden_0649 von Willebrand factor, type A; PFAM:
FT                   von Willebrand factor type A; Tetratricopeptide TPR_1
FT                   repeat-containing protein; SMART: von Willebrand factor
FT                   type A; Tetratricopeptide repeat; SPTR: von Willebrand
FT                   factor, type A; PFAM: von Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33091"
FT                   /db_xref="GOA:E4TZK3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK3"
FT                   /protein_id="ADR33091.1"
FT                   /translation="MMFLTPLWLGALVIVPLYVWQVKRSGWSKQGWLLASIALLILSLA
FT                   RPVLPQKPVTAEEAGSDVIFAVDLSYSMRGTDLAPSRLEVAKKLLYDVVRSDQKDRFGV
FT                   IGFTTSAIVLSPLTKDTEMLEHLFSSLDESQIITKGTNVMSALELSRKMSHSARPIVIL
FT                   LTDGGDEASYEKESSFVRDNNLALSVVMLATNNGSTLPTSEGSSLKDENGHIVVSARND
FT                   AIEEIVNKGKVIRNTRAGEILSLIDSARENDFTGKTSVMRYQELFYVPLMLSLIAFVAA
FT                   FTTVGKKISRLFIPALALIGVSAQGGMLDFGYIYLAEINYTHGNFERSAELYRHVEGER
FT                   ARYNRANALYKAGKYADALGLYRSIRSNNASFKANIFYNMGNCHIRLQEFGEARESFLK
FT                   SLTLRYTRAADQNLRAITEVKEHQTLNVRKEKNDSFASEENKPTGAKKTSKEGGGSNMK
FT                   TDTASGGGGDEGKRAQSDPRFSMSQGKAALSSRQYELINQRSVHETKPW"
     MMFLTPLWLG ALVIVPLYVW QVKRSGWSKQ GWLLASIALL ILSLARPVLP QKPVTAEEAG        60
     SDVIFAVDLS YSMRGTDLAP SRLEVAKKLL YDVVRSDQKD RFGVIGFTTS AIVLSPLTKD       120
     TEMLEHLFSS LDESQIITKG TNVMSALELS RKMSHSARPI VILLTDGGDE ASYEKESSFV       180
     RDNNLALSVV MLATNNGSTL PTSEGSSLKD ENGHIVVSAR NDAIEEIVNK GKVIRNTRAG       240
     EILSLIDSAR ENDFTGKTSV MRYQELFYVP LMLSLIAFVA AFTTVGKKIS RLFIPALALI       300
     GVSAQGGMLD FGYIYLAEIN YTHGNFERSA ELYRHVEGER ARYNRANALY KAGKYADALG       360
     LYRSIRSNNA SFKANIFYNM GNCHIRLQEF GEARESFLKS LTLRYTRAAD QNLRAITEVK       420
     EHQTLNVRKE KNDSFASEEN KPTGAKKTSK EGGGSNMKTD TASGGGGDEG KRAQSDPRFS       480
     MSQGKAALSS RQYELINQRS VHETKPW                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page