(data stored in ACNUC7421 zone)

EMBL: CP002355.PE424

CP002355.PE424       Location/Qualifiers
FT   CDS             414387..415502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0650 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33092"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK4"
FT                   /protein_id="ADR33092.1"
FT                   /translation="MRRSLGRAVILMVLCPLLGWGAMYQWSVLKSPQSLYVNQSGVIRY
FT                   ECTFSTSAADYTITFNPISNESYKVSILTQRDQIIGGKRVQTFDVLITPKKEGNIDVSL
FT                   EALIRHTTFASIENASIGRDNVKKYDFDDEKAHLPKVVIEAKPNSAALSGELSLEVKVD
FT                   KRNALAHEPVHLSLYIRGRGNLDQYTPYELNISGVNIFGEEPIRDISPDPAGFAGEIRQ
FT                   EFAIVSDKSYVIPSITLDVFDSTTQKIKRLQSDSIAIEVAQGFERSDLLDPPGLRDWSN
FT                   LARYSLYAALVIAGAVLGEIARRLWRLRPRRKSKQFWDEAKNPKELAMFLALSGDKRYD
FT                   EIIGLLESGAVGLGEAKKKLSTLTTDKEEIA"
     MRRSLGRAVI LMVLCPLLGW GAMYQWSVLK SPQSLYVNQS GVIRYECTFS TSAADYTITF        60
     NPISNESYKV SILTQRDQII GGKRVQTFDV LITPKKEGNI DVSLEALIRH TTFASIENAS       120
     IGRDNVKKYD FDDEKAHLPK VVIEAKPNSA ALSGELSLEV KVDKRNALAH EPVHLSLYIR       180
     GRGNLDQYTP YELNISGVNI FGEEPIRDIS PDPAGFAGEI RQEFAIVSDK SYVIPSITLD       240
     VFDSTTQKIK RLQSDSIAIE VAQGFERSDL LDPPGLRDWS NLARYSLYAA LVIAGAVLGE       300
     IARRLWRLRP RRKSKQFWDE AKNPKELAMF LALSGDKRYD EIIGLLESGA VGLGEAKKKL       360
     STLTTDKEEI A                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page