(data stored in ACNUC7421 zone)

EMBL: CP002355.PE426

CP002355.PE426       Location/Qualifiers
FT   CDS             416449..417282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0427"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: tdn:Suden_0654
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33094"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK6"
FT                   /protein_id="ADR33094.1"
FT                   /translation="MKNSRHILLKARRQIIGDRIGNNPSMFRGEGYDFIELREYVSGDD
FT                   TRHIDWNITAKMQRPFIKVFREERELSVVTVAMLGGSLHFGQERFKIDALAEAVALIGY
FT                   SALANGDLFTHIDFSETLRNEVRASKKRFAVAQSVEGIMDTPILQHRADYNAMASSLYR
FT                   RLKRRSLIVVIGDFFEIPDLRLLAKKHEVVAVVVRDRFEEKPSPMGFSALIDPQSGAVL
FT                   EGDFNARSVRKYHEKVREHDAGLFDRLRRDGIRAAKLYTDASVSVVLRRLFEGRV"
     MKNSRHILLK ARRQIIGDRI GNNPSMFRGE GYDFIELREY VSGDDTRHID WNITAKMQRP        60
     FIKVFREERE LSVVTVAMLG GSLHFGQERF KIDALAEAVA LIGYSALANG DLFTHIDFSE       120
     TLRNEVRASK KRFAVAQSVE GIMDTPILQH RADYNAMASS LYRRLKRRSL IVVIGDFFEI       180
     PDLRLLAKKH EVVAVVVRDR FEEKPSPMGF SALIDPQSGA VLEGDFNARS VRKYHEKVRE       240
     HDAGLFDRLR RDGIRAAKLY TDASVSVVLR RLFEGRV                                277
//

If you have problems or comments...

PBIL Back to PBIL home page