(data stored in ACNUC7421 zone)

EMBL: CP002355.PE427

CP002355.PE427       Location/Qualifiers
FT   CDS             417279..417677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0655 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33095"
FT                   /db_xref="GOA:E4TZK7"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK7"
FT                   /protein_id="ADR33095.1"
FT                   /translation="MSQMADIPVNDIAPLVQVHDYSIYLFGGSVTIAFVITLSLILFVL
FT                   KKWRARRLSERKRLYHLLGSIDLSDSKRAAYKISELGRIFSADNERTERAYHNLFERLE
FT                   PYKYAPKVEPFTEEVVGYYRLYLEIIDV"
     MSQMADIPVN DIAPLVQVHD YSIYLFGGSV TIAFVITLSL ILFVLKKWRA RRLSERKRLY        60
     HLLGSIDLSD SKRAAYKISE LGRIFSADNE RTERAYHNLF ERLEPYKYAP KVEPFTEEVV       120
     GYYRLYLEII DV                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page