(data stored in ACNUC7421 zone)

EMBL: CP002355.PE428

CP002355.PE428       Location/Qualifiers
FT   CDS             417670..418410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0656 von Willebrand factor, type A;
FT                   SPTR: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33096"
FT                   /db_xref="GOA:E4TZK8"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK8"
FT                   /protein_id="ADR33096.1"
FT                   /translation="MFEGIYFQFPKLAFLLFFFLACEALCPLRSNPLYFPRPILFGEVG
FT                   VKPPIWLWIAKWAMIAFLVIALMSPVRDREAARHERGWDILLIVDPLLTGTAAIPQIIS
FT                   FMNRRMDERIALWVPENTIVPLTYEHKALISILKQTPVPESSGEATLNISRFFATSQEG
FT                   HKVAIIFSENPKSFLTTLPIGIQTAMISPLKEPQWADTLNRTYPSYKVKQSHRYFDYYY
FT                   VYPLFLGFLSMLAYLYGRNQKGIR"
     MFEGIYFQFP KLAFLLFFFL ACEALCPLRS NPLYFPRPIL FGEVGVKPPI WLWIAKWAMI        60
     AFLVIALMSP VRDREAARHE RGWDILLIVD PLLTGTAAIP QIISFMNRRM DERIALWVPE       120
     NTIVPLTYEH KALISILKQT PVPESSGEAT LNISRFFATS QEGHKVAIIF SENPKSFLTT       180
     LPIGIQTAMI SPLKEPQWAD TLNRTYPSYK VKQSHRYFDY YYVYPLFLGF LSMLAYLYGR       240
     NQKGIR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page