(data stored in ACNUC7421 zone)

EMBL: CP002355.PE429

CP002355.PE429       Location/Qualifiers
FT   CDS             418407..419543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0657 von Willebrand factor, type A;
FT                   SPTR: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33097"
FT                   /db_xref="GOA:E4TZK9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK9"
FT                   /protein_id="ADR33097.1"
FT                   /translation="MSFLHAEFFVWMVLPVLVLFYFWQTQKSPHSAVFGEAVFNRLHAP
FT                   EITMGLRTRNILFLIAALLLIAAMAQPVILQDEAASEGRADVLIALDLSKKSLEAFEEE
FT                   KRTAINTIRRLKGENIAVFGYDTRPYRITPYTTDSEMAAALVSGLDSEVMRQFKSDSSA
FT                   LDKFRSDEGMIIIIGDPTNEHNTRLSGIIERIEKIKTAQRLYVHVPLFYYPLGLAMVLI
FT                   WIALSSMSKRRSVPAAAILMALSIGNVSGHAGILDFQILNSGYRAYEKGDYLQSAHYFK
FT                   SYQNAHDSPEIRYNIANALYKAGAYREALYWYRQVHTSNPLLAQKAAYNLSLCEAKIHI
FT                   GSKSGENQKRDRDEPISHEIQPLPKKSPNEIKTRLYPM"
     MSFLHAEFFV WMVLPVLVLF YFWQTQKSPH SAVFGEAVFN RLHAPEITMG LRTRNILFLI        60
     AALLLIAAMA QPVILQDEAA SEGRADVLIA LDLSKKSLEA FEEEKRTAIN TIRRLKGENI       120
     AVFGYDTRPY RITPYTTDSE MAAALVSGLD SEVMRQFKSD SSALDKFRSD EGMIIIIGDP       180
     TNEHNTRLSG IIERIEKIKT AQRLYVHVPL FYYPLGLAMV LIWIALSSMS KRRSVPAAAI       240
     LMALSIGNVS GHAGILDFQI LNSGYRAYEK GDYLQSAHYF KSYQNAHDSP EIRYNIANAL       300
     YKAGAYREAL YWYRQVHTSN PLLAQKAAYN LSLCEAKIHI GSKSGENQKR DRDEPISHEI       360
     QPLPKKSPNE IKTRLYPM                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page