(data stored in ACNUC7421 zone)

EMBL: CP002355.PE43

CP002355.PE43        Location/Qualifiers
FT   CDS             42898..43401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0043"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /note="COGs: COG2077 Peroxiredoxin; InterPro IPR018219:
FT                   IPR017936: IPR013740; KEGG: tdn:Suden_0132 thiol
FT                   peroxidase; PFAM: Redoxin domain protein; SPTR: Thiol
FT                   peroxidase (Atypical 2-Cys peroxiredoxin); PFAM: Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32711"
FT                   /db_xref="GOA:E4TW95"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW95"
FT                   /protein_id="ADR32711.1"
FT                   /translation="MATTMLKGNVVNLAGNTVNVGDKAPAVTVVNSNGLADKVVGGASG
FT                   KKQLIVVVPSLDTAVCATETRNFNKRASEIEGVDLTVVSMDLPFAAGRFCSTEGIENLV
FT                   VASDFRNKDFANAYGVLIADGALAGVTCRAIFAVNEEGTVIYKEIVPEITAEPEYEAAL
FT                   AAVK"
     MATTMLKGNV VNLAGNTVNV GDKAPAVTVV NSNGLADKVV GGASGKKQLI VVVPSLDTAV        60
     CATETRNFNK RASEIEGVDL TVVSMDLPFA AGRFCSTEGI ENLVVASDFR NKDFANAYGV       120
     LIADGALAGV TCRAIFAVNE EGTVIYKEIV PEITAEPEYE AALAAVK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page