(data stored in ACNUC7421 zone)

EMBL: CP002355.PE431

CP002355.PE431       Location/Qualifiers
FT   CDS             420488..422728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0432"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="COGs: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; InterPro IPR016474: IPR010827: IPR000184:
FT                   IPR020785; KEGG: tdn:Suden_0660 surface antigen (D15);
FT                   PFAM: surface antigen (D15); surface antigen variable
FT                   number repeat-containing protein; SPTR: Outer membrane
FT                   protein assembly complex, YaeT protein; TIGRFAM: outer
FT                   membrane protein assembly complex, YaeT protein; PFAM:
FT                   Surface antigen variable number repeat; Surface antigen;
FT                   TIGRFAM: outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33099"
FT                   /db_xref="GOA:E4TZL1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL1"
FT                   /protein_id="ADR33099.1"
FT                   /translation="MKTITLSLIVASALVHASAQNVQSIHYDGMVHISEAVAKRLNEVK
FT                   VGEPLNAAAVDKTVKNFFEQGYFEDVWAEEEEGKVTFHFKEKPTISKIELKGYKENDEE
FT                   AKKALLQIDKGSLYDPKRVEEAKKRIVDALSQDGKIDSVVEIETEKLENGSMRVTFIAN
FT                   EGQEIIIKKLTYAGVLTQDSEEFDSMIANKEEQFMGWMWGRNDGKMKVAELQYDPLRIR
FT                   DFYMQRGFLDAKIDEPFVAVDFDHYTAQMSYNIFEGDVYRVSDILLFQDTKVIDDQALL
FT                   DVITLEKNKPFNIKTFREDAERIKTKIADLGYAYVQVQPDLKKDKEGKSVDVVYRIIPG
FT                   KKVHIRKVIISGNNRTLDRVVRRELFLAPGDLYSLTNLKDSRNAIGRTGYFESNTIEEK
FT                   RIDDETMDLIVQTKEAPTGNIQLGGGYGSFGGILVSVAVSDRNIFGSGINVGLNLEKSQ
FT                   RTSNYSFNISNPRLNDSDFSGNFSVYNSSTEYDSYSTDSKGISVGTGHRFNRFVNGYVG
FT                   YNYSQNSYSDIDLNTTTLDPRYYESYSKSSVVVSATFDNTDDYYVPREGMTLSESIEMA
FT                   GVGGDAEFWKSRTTFGVYQGLQKWTDFDLILRYKARFNYASEGGGYLPLGEKFYMGGIG
FT                   SVRGYQAYSISPTKGVDRNGDPYKIGGTQTFSNNLEFSVPLVPEAKMRATAFIDYGMIG
FT                   ESSISEIKRGGYGVSLEWFSPVGPLQLVFANPIGDKEHDDIAHFEFTIGQRF"
     MKTITLSLIV ASALVHASAQ NVQSIHYDGM VHISEAVAKR LNEVKVGEPL NAAAVDKTVK        60
     NFFEQGYFED VWAEEEEGKV TFHFKEKPTI SKIELKGYKE NDEEAKKALL QIDKGSLYDP       120
     KRVEEAKKRI VDALSQDGKI DSVVEIETEK LENGSMRVTF IANEGQEIII KKLTYAGVLT       180
     QDSEEFDSMI ANKEEQFMGW MWGRNDGKMK VAELQYDPLR IRDFYMQRGF LDAKIDEPFV       240
     AVDFDHYTAQ MSYNIFEGDV YRVSDILLFQ DTKVIDDQAL LDVITLEKNK PFNIKTFRED       300
     AERIKTKIAD LGYAYVQVQP DLKKDKEGKS VDVVYRIIPG KKVHIRKVII SGNNRTLDRV       360
     VRRELFLAPG DLYSLTNLKD SRNAIGRTGY FESNTIEEKR IDDETMDLIV QTKEAPTGNI       420
     QLGGGYGSFG GILVSVAVSD RNIFGSGINV GLNLEKSQRT SNYSFNISNP RLNDSDFSGN       480
     FSVYNSSTEY DSYSTDSKGI SVGTGHRFNR FVNGYVGYNY SQNSYSDIDL NTTTLDPRYY       540
     ESYSKSSVVV SATFDNTDDY YVPREGMTLS ESIEMAGVGG DAEFWKSRTT FGVYQGLQKW       600
     TDFDLILRYK ARFNYASEGG GYLPLGEKFY MGGIGSVRGY QAYSISPTKG VDRNGDPYKI       660
     GGTQTFSNNL EFSVPLVPEA KMRATAFIDY GMIGESSISE IKRGGYGVSL EWFSPVGPLQ       720
     LVFANPIGDK EHDDIAHFEF TIGQRF                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page