(data stored in ACNUC7421 zone)

EMBL: CP002355.PE434

CP002355.PE434       Location/Qualifiers
FT   CDS             complement(424687..425988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0435"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003660: IPR003661: IPR003594: IPR004358: IPR
FT                   005467; KEGG: tdn:Suden_0663 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SPTR: Histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33102"
FT                   /db_xref="GOA:E4TZL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL4"
FT                   /protein_id="ADR33102.1"
FT                   /translation="MFSKRSIRRRFLFQLIVASAALVILFSSFLYLFIKQSIYDEKQAE
FT                   LIGYAENISSYKSLLSTQQNNADTMMGLTVELITLSQNDEHLDFYETTHKDKSTTLTLI
FT                   YPFDFEHSSYLKVSRDITPTKRLLRKIMNSIYLINAVGFVVIILYAIAFSKMLIAPISA
FT                   LSRRLANMNEHLIRPIKVEQLPDEFEPLGETLNRLIARIQNFVKYQKELFIGAAHELKT
FT                   PLAVIKLKNQVTLIKKRTPEEYIEAIKITNQSVDEMNKIVADILNIGRQEGAQLEIPVQ
FT                   TDIIQILKKWEGDFKLLANSENKTLLTRFEPDAFSAVLQVTLLNQILQNFLQNALKFTP
FT                   EGKTILFQSHMNGVGIVIEVIDEGCGIDESVDLFAPFKRQGNKSGVGLGLFLAKSAAEA
FT                   IGATITLTNREDGIDGTCARLILPSKLCCVIPQR"
     MFSKRSIRRR FLFQLIVASA ALVILFSSFL YLFIKQSIYD EKQAELIGYA ENISSYKSLL        60
     STQQNNADTM MGLTVELITL SQNDEHLDFY ETTHKDKSTT LTLIYPFDFE HSSYLKVSRD       120
     ITPTKRLLRK IMNSIYLINA VGFVVIILYA IAFSKMLIAP ISALSRRLAN MNEHLIRPIK       180
     VEQLPDEFEP LGETLNRLIA RIQNFVKYQK ELFIGAAHEL KTPLAVIKLK NQVTLIKKRT       240
     PEEYIEAIKI TNQSVDEMNK IVADILNIGR QEGAQLEIPV QTDIIQILKK WEGDFKLLAN       300
     SENKTLLTRF EPDAFSAVLQ VTLLNQILQN FLQNALKFTP EGKTILFQSH MNGVGIVIEV       360
     IDEGCGIDES VDLFAPFKRQ GNKSGVGLGL FLAKSAAEAI GATITLTNRE DGIDGTCARL       420
     ILPSKLCCVI PQR                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page