(data stored in ACNUC7421 zone)

EMBL: CP002355.PE436

CP002355.PE436       Location/Qualifiers
FT   CDS             complement(426717..427043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0437"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="COGs: COG1539 Dihydroneopterin aldolase; InterPro
FT                   IPR006157; KEGG: sun:SUN_1982 hypothetical protein; PFAM:
FT                   dihydroneopterin aldolase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Dihydroneopterin aldolase; TIGRFAM:
FT                   dihydroneopterin aldolase; FolB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33104"
FT                   /db_xref="GOA:E4TZL6"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL6"
FT                   /protein_id="ADR33104.1"
FT                   /translation="MKILIENLTFDAIIGILDFERTDPQQVQIDCTIDYTYTGDNFINY
FT                   ADIACMIETTVQTEQFELIETALEVLAAKLKLSFPLIDALSLTFRKPNILPNCTVGVQK
FT                   NFIF"
     MKILIENLTF DAIIGILDFE RTDPQQVQID CTIDYTYTGD NFINYADIAC MIETTVQTEQ        60
     FELIETALEV LAAKLKLSFP LIDALSLTFR KPNILPNCTV GVQKNFIF                    108
//

If you have problems or comments...

PBIL Back to PBIL home page