(data stored in ACNUC7421 zone)

EMBL: CP002355.PE437

CP002355.PE437       Location/Qualifiers
FT   CDS             complement(427040..427654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0438"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="COGs: COG0344 membrane protein; InterPro IPR020788:
FT                   IPR003811; KEGG: tdn:Suden_0666 putative
FT                   glycerol-3-phosphate acyltransferase PlsY; PFAM: protein of
FT                   unknown function DUF205; SPTR: Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF205);
FT                   TIGRFAM: acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33105"
FT                   /db_xref="GOA:E4TZL7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL7"
FT                   /protein_id="ADR33105.1"
FT                   /translation="MDFLFNLNVQFYLAAYLLGGIPFGLILAKVFAGVNITEAGSQSIG
FT                   ATNVLRVVKETNPSLAKKLGAATLALDALKGIIVVLAAKYFELSDSAQWLVAVLAVVGH
FT                   CFSPYMWFEGGKGVATGMGVMAVMLPVPTVIALVVWAVAAKTIRISSLSSMLGLAALVV
FT                   SSFILYPAMFHAPVLFIAFILFYKHIPNFVRLVKGEEKRVA"
     MDFLFNLNVQ FYLAAYLLGG IPFGLILAKV FAGVNITEAG SQSIGATNVL RVVKETNPSL        60
     AKKLGAATLA LDALKGIIVV LAAKYFELSD SAQWLVAVLA VVGHCFSPYM WFEGGKGVAT       120
     GMGVMAVMLP VPTVIALVVW AVAAKTIRIS SLSSMLGLAA LVVSSFILYP AMFHAPVLFI       180
     AFILFYKHIP NFVRLVKGEE KRVA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page