(data stored in ACNUC7421 zone)

EMBL: CP002355.PE438

CP002355.PE438       Location/Qualifiers
FT   CDS             427808..428800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0439"
FT                   /product="quinolinate synthetase A"
FT                   /EC_number="2.5.1.72"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: tdn:Suden_0667 quinolinate synthetase;
FT                   PFAM: Quinolinate synthetase A; PRIAM: Quinolinate
FT                   synthase; SPTR: Quinolinate synthetase complex, A subunit;
FT                   TIGRFAM: quinolinate synthetase complex, A subunit; PFAM:
FT                   Quinolinate synthetase A protein; TIGRFAM: quinolinate
FT                   synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33106"
FT                   /db_xref="GOA:E4TZL8"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL8"
FT                   /protein_id="ADR33106.1"
FT                   /translation="MNTEELKQKIIDLKNRLSVTVVAHFYQRDEVFEMGDITGDSLELA
FT                   KRTMADDKEFVVFCGVGFMGQSVKILSPEKRVVMPKVACCAMAKMIDGLYYDQSIAKLE
FT                   EAGIKADDILPITYINSDAAVKARVGKMGGMVCTSSNAKIIITKALGEGKKILFVPDRC
FT                   LGQNIARQMGLKSCVIGDGTDPKEADIICYDGFCSVHQLFSVEDIEFYRNKYPGILIAV
FT                   HPECDPAICERADFVGSTSQLIKYITELPANQKVAVGTEFNMVNRLRPSNTYILSSTKP
FT                   ECPTMNETTLEDLYAVLKSIEEGAPINEIEVDEDTAHWAKIALERMMAL"
     MNTEELKQKI IDLKNRLSVT VVAHFYQRDE VFEMGDITGD SLELAKRTMA DDKEFVVFCG        60
     VGFMGQSVKI LSPEKRVVMP KVACCAMAKM IDGLYYDQSI AKLEEAGIKA DDILPITYIN       120
     SDAAVKARVG KMGGMVCTSS NAKIIITKAL GEGKKILFVP DRCLGQNIAR QMGLKSCVIG       180
     DGTDPKEADI ICYDGFCSVH QLFSVEDIEF YRNKYPGILI AVHPECDPAI CERADFVGST       240
     SQLIKYITEL PANQKVAVGT EFNMVNRLRP SNTYILSSTK PECPTMNETT LEDLYAVLKS       300
     IEEGAPINEI EVDEDTAHWA KIALERMMAL                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page