(data stored in ACNUC7421 zone)

EMBL: CP002355.PE439

CP002355.PE439       Location/Qualifiers
FT   CDS             428797..429612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0440"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR004393: IPR002638; KEGG:
FT                   tdn:Suden_0668 nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; PRIAM:
FT                   Nicotinate-nucleotide diphosphorylase (carboxylating);
FT                   SPTR: Nicotinate-nucleotide pyrophosphorylase; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase, C-terminal domain; Quinolinate
FT                   phosphoribosyl transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33107"
FT                   /db_xref="GOA:E4TZL9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL9"
FT                   /protein_id="ADR33107.1"
FT                   /translation="MIEQFIREVLAEDVGRGDLYARVSDAVSASAKIIAKSDGVIAGEA
FT                   YLKVLAEIEKFNIIWHKHDGDRFVKGEVLMELSGDSHTLLRIERTLLNMLLHASSIATL
FT                   TRKYVDLIAPYGTKLLDTRKTRPLLRNFEKYATRIGGATNHRMGLDDALMLKDTHLKTI
FT                   TNLESFMEEARKKIPFTSKIEIEAEDFEMAAHAMRCGADIVMCDNMTVEQLTEVVKYKW
FT                   EHHSGVLLEASGNITLETIEAYAASGVDAISTGALIHQANWIDMSMKMD"
     MIEQFIREVL AEDVGRGDLY ARVSDAVSAS AKIIAKSDGV IAGEAYLKVL AEIEKFNIIW        60
     HKHDGDRFVK GEVLMELSGD SHTLLRIERT LLNMLLHASS IATLTRKYVD LIAPYGTKLL       120
     DTRKTRPLLR NFEKYATRIG GATNHRMGLD DALMLKDTHL KTITNLESFM EEARKKIPFT       180
     SKIEIEAEDF EMAAHAMRCG ADIVMCDNMT VEQLTEVVKY KWEHHSGVLL EASGNITLET       240
     IEAYAASGVD AISTGALIHQ ANWIDMSMKM D                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page