(data stored in ACNUC7421 zone)

EMBL: CP002355.PE44

CP002355.PE44        Location/Qualifiers
FT   CDS             complement(43460..44074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1999 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32712"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW96"
FT                   /protein_id="ADR32712.1"
FT                   /translation="MKKYSLFLSLLLLSHLIARENPFFASDEAKKQKVTSNISDARPQM
FT                   GTLSYTFPDQARVLKEITFTVQNLDGSIEEKKLQIDQSIDWHRALIISQGGSSPHLTAK
FT                   NSSSAANFGFIQLYSKGKSLTIKSSDPLIRHFALSNPNSIVLDFKHEASFKSDQKTLNA
FT                   APYLNVSVGNHGKFARATITLDGHYAYTLSKENGLITIICK"
     MKKYSLFLSL LLLSHLIARE NPFFASDEAK KQKVTSNISD ARPQMGTLSY TFPDQARVLK        60
     EITFTVQNLD GSIEEKKLQI DQSIDWHRAL IISQGGSSPH LTAKNSSSAA NFGFIQLYSK       120
     GKSLTIKSSD PLIRHFALSN PNSIVLDFKH EASFKSDQKT LNAAPYLNVS VGNHGKFARA       180
     TITLDGHYAY TLSKENGLIT IICK                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page