(data stored in ACNUC7421 zone)

EMBL: CP002355.PE440

CP002355.PE440       Location/Qualifiers
FT   CDS             429616..430683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0441"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="COGs: COG1377 Flagellar biosynthesis pathway
FT                   component FlhB; InterPro IPR006136: IPR006135; KEGG:
FT                   tdn:Suden_0669 flagellar biosynthesis protein FlhB; PFAM:
FT                   type III secretion exporter; SPTR: Flagellar biosynthetic
FT                   protein FlhB; TIGRFAM: flagellar biosynthetic protein FlhB;
FT                   PFAM: FlhB HrpN YscU SpaS Family; TIGRFAM: flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33108"
FT                   /db_xref="GOA:E4TZM0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM0"
FT                   /protein_id="ADR33108.1"
FT                   /translation="MADDQEKTEEPTAKKLEDARAEGNVPKSQDVVGVVVLFVSILAVL
FT                   MMFTFIADRMLHLSQYYFSLMRQPLDRELMVDLAVVTMKEFLIMALPVSIIVAVAGVFG
FT                   TVAQIGFNFTTKPLTPNFSKLDPIKGFANLFTLQKGLESIKITLKSFTALGIGFLYFWY
FT                   FVEELPTVALFTLQDQMGWLRDKAIVLASVMLLIIFVYAVIDLFLVRKHYFDKLKMSLQ
FT                   EIKDEMKNMEGDPHIKAKIRQIQMQAARKRMMTSVPTADVVITNPTHYAVAIVYDENKH
FT                   NAPVVVAKGVDNMAIQIKKVARENGVHIVQNPPLARSLYKEVDIDHPIPDMLFAAVAEV
FT                   LAYVYKMGKKRKGNS"
     MADDQEKTEE PTAKKLEDAR AEGNVPKSQD VVGVVVLFVS ILAVLMMFTF IADRMLHLSQ        60
     YYFSLMRQPL DRELMVDLAV VTMKEFLIMA LPVSIIVAVA GVFGTVAQIG FNFTTKPLTP       120
     NFSKLDPIKG FANLFTLQKG LESIKITLKS FTALGIGFLY FWYFVEELPT VALFTLQDQM       180
     GWLRDKAIVL ASVMLLIIFV YAVIDLFLVR KHYFDKLKMS LQEIKDEMKN MEGDPHIKAK       240
     IRQIQMQAAR KRMMTSVPTA DVVITNPTHY AVAIVYDENK HNAPVVVAKG VDNMAIQIKK       300
     VARENGVHIV QNPPLARSLY KEVDIDHPIP DMLFAAVAEV LAYVYKMGKK RKGNS            355
//

If you have problems or comments...

PBIL Back to PBIL home page