(data stored in ACNUC7421 zone)

EMBL: CP002355.PE441

CP002355.PE441       Location/Qualifiers
FT   CDS             430683..431810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0257 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33109"
FT                   /db_xref="GOA:E4TZM1"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM1"
FT                   /protein_id="ADR33109.1"
FT                   /translation="MERWVGLLSNKKVIASVFLVIMAILGIVLWQLEKKVTSQTLERLS
FT                   DQLSLAINNQLEKERSSALRYALILSQNTALSDALERDDEDKGFKILSEGMESIKVHTD
FT                   SLIRSQVITSDYVIFARSWDNSYAGMPLEFHRPDLLYFQNHKNPRSAIEVGRKLGVKAT
FT                   VPVYRDDKMLGFVEVVSFFESTQEYFDRLGIDMYVLMDVRFYDTAVFMQENPTIAKEYI
FT                   LANPKYTQSDLKLLNGIDFKTLKHTHVVFSGGRYLFFEPMKNGEGETIGAFVFSLSPKQ
FT                   INAYAHSDEEDISFLIHLSRNELYDVMIKKSLDDGLFQSVYDKELLYLKDTVAPEDREL
FT                   FVQEAHERLDAYSKEELIGIMLNYKVTKEIKGEIR"
     MERWVGLLSN KKVIASVFLV IMAILGIVLW QLEKKVTSQT LERLSDQLSL AINNQLEKER        60
     SSALRYALIL SQNTALSDAL ERDDEDKGFK ILSEGMESIK VHTDSLIRSQ VITSDYVIFA       120
     RSWDNSYAGM PLEFHRPDLL YFQNHKNPRS AIEVGRKLGV KATVPVYRDD KMLGFVEVVS       180
     FFESTQEYFD RLGIDMYVLM DVRFYDTAVF MQENPTIAKE YILANPKYTQ SDLKLLNGID       240
     FKTLKHTHVV FSGGRYLFFE PMKNGEGETI GAFVFSLSPK QINAYAHSDE EDISFLIHLS       300
     RNELYDVMIK KSLDDGLFQS VYDKELLYLK DTVAPEDREL FVQEAHERLD AYSKEELIGI       360
     MLNYKVTKEI KGEIR                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page