(data stored in ACNUC7421 zone)

EMBL: CP002355.PE443

CP002355.PE443       Location/Qualifiers
FT   CDS             432450..433613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0444"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661: IPR003594: IPR004358: IPR005467; KEGG:
FT                   tdn:Suden_0259 histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SPTR: Histidine kinase; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33111"
FT                   /db_xref="GOA:E4TZM3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM3"
FT                   /protein_id="ADR33111.1"
FT                   /translation="MNDKLYALKNAFIYTMLVAVLLLVPTYVYVAYMKYVYEIQYEFKL
FT                   KRESHLILRSMEEFDVKEKQVFDYPRFRSFQSGLYDEHFKPMFSLIEYPIENQKVGYYV
FT                   DNGYGYLVISLPEHRYFGASYLVVGGELSYTRIYQDVVIILLSIAVLIFVLSLFFLDRF
FT                   ALPFQRVNQRLDRFIKDSMHEINTPLSIINVNIDLYNRSNPPNKYLQRIKAATKTLATL
FT                   YNDMDYLIKNERLSFEYEEIDLSRYLQDRIDYFYEVAALKNIAVESRIEDDIFIQFNPT
FT                   QLQRIIDNNLSNAIKYSHEEGKIEVILERIGDICVMRFQDYGVGIENVERIFERYYREN
FT                   RDKGGFGIGLNIVKSIIDKAGIELHIDSIYGKGTTFSYTFFPPIFIL"
     MNDKLYALKN AFIYTMLVAV LLLVPTYVYV AYMKYVYEIQ YEFKLKRESH LILRSMEEFD        60
     VKEKQVFDYP RFRSFQSGLY DEHFKPMFSL IEYPIENQKV GYYVDNGYGY LVISLPEHRY       120
     FGASYLVVGG ELSYTRIYQD VVIILLSIAV LIFVLSLFFL DRFALPFQRV NQRLDRFIKD       180
     SMHEINTPLS IINVNIDLYN RSNPPNKYLQ RIKAATKTLA TLYNDMDYLI KNERLSFEYE       240
     EIDLSRYLQD RIDYFYEVAA LKNIAVESRI EDDIFIQFNP TQLQRIIDNN LSNAIKYSHE       300
     EGKIEVILER IGDICVMRFQ DYGVGIENVE RIFERYYREN RDKGGFGIGL NIVKSIIDKA       360
     GIELHIDSIY GKGTTFSYTF FPPIFIL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page