(data stored in ACNUC7421 zone)

EMBL: CP002355.PE445

CP002355.PE445       Location/Qualifiers
FT   CDS             434233..434703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0446"
FT                   /product="thiosulfate-binding protein SoxY"
FT                   /note="COGs: COG5501 secreted protein; InterPro IPR006311:
FT                   IPR016568: IPR017909; KEGG: sun:SUN_0498 sulfur oxidation
FT                   protein SoxY; SPTR: Twin-arginine translocation pathway
FT                   signal; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33113"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM5"
FT                   /protein_id="ADR33113.1"
FT                   /translation="MERRSFLKGFGAAAACAIALPHVASAAEEKKSGGPNEMNFETAVA
FT                   AITGGKALTPSAKVKMEAPEIAENGAVVPVKVTVDSPMSAKEYVKAIHILASKNGNVRC
FT                   ANIYLTPANGEAYFGTRIKLGGTQDVVAIAEMSDGTFLSAKQNVKVTIGGCG"
     MERRSFLKGF GAAAACAIAL PHVASAAEEK KSGGPNEMNF ETAVAAITGG KALTPSAKVK        60
     MEAPEIAENG AVVPVKVTVD SPMSAKEYVK AIHILASKNG NVRCANIYLT PANGEAYFGT       120
     RIKLGGTQDV VAIAEMSDGT FLSAKQNVKV TIGGCG                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page