(data stored in ACNUC7421 zone)

EMBL: CP002355.PE446

CP002355.PE446       Location/Qualifiers
FT   CDS             434753..435079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0447"
FT                   /product="sulfur compound chelating protein SoxZ"
FT                   /note="InterPro IPR014880; KEGG: nis:NIS_1830 hypothetical
FT                   protein; PFAM: Sulphur oxidation protein SoxZ; SPTR:
FT                   Putative uncharacterized protein; PFAM: Sulphur oxidation
FT                   protein SoxZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33114"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM6"
FT                   /protein_id="ADR33114.1"
FT                   /translation="MKTLIKIKPKDYKAGDIVKIDFMAMHPMETGMRKNKDTGALIPAE
FT                   YIDEVKFMFNDTLITKMVIWESLSVNPLMSISFKVPGAGTLKVIAKDNKGQSVETTSAI
FT                   NPKG"
     MKTLIKIKPK DYKAGDIVKI DFMAMHPMET GMRKNKDTGA LIPAEYIDEV KFMFNDTLIT        60
     KMVIWESLSV NPLMSISFKV PGAGTLKVIA KDNKGQSVET TSAINPKG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page