(data stored in ACNUC7421 zone)

EMBL: CP002355.PE447

CP002355.PE447       Location/Qualifiers
FT   CDS             435083..435856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0448"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR009056; KEGG: nis:NIS_1829 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33115"
FT                   /db_xref="GOA:E4TZM7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM7"
FT                   /protein_id="ADR33115.1"
FT                   /translation="MRTLSITAALVCLAFLATANAEEKLSMSDADKKMYAELLESNPAE
FT                   MDVAEGEQLFGELIGNANYAKMLGVKEKDLPKFIAGFPRYLEPAKRVVTIAQSIQMAAA
FT                   ANDKPVPKLESNEMVKMSAYVKSIANGQKTNIDVKANKHMVEMMKLGQQVFEERRGGRG
FT                   LSCNNCHSADIVGQRLRMQPLPDLGAKETAAAGTWPAYRMTQSQMVTLDKRMQQCMKNA
FT                   LLAEIPLGSKEIVALEVFVTNKTKGNNISVPSVKR"
     MRTLSITAAL VCLAFLATAN AEEKLSMSDA DKKMYAELLE SNPAEMDVAE GEQLFGELIG        60
     NANYAKMLGV KEKDLPKFIA GFPRYLEPAK RVVTIAQSIQ MAAAANDKPV PKLESNEMVK       120
     MSAYVKSIAN GQKTNIDVKA NKHMVEMMKL GQQVFEERRG GRGLSCNNCH SADIVGQRLR       180
     MQPLPDLGAK ETAAAGTWPA YRMTQSQMVT LDKRMQQCMK NALLAEIPLG SKEIVALEVF       240
     VTNKTKGNNI SVPSVKR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page