(data stored in ACNUC7421 zone)

EMBL: CP002355.PE448

CP002355.PE448       Location/Qualifiers
FT   CDS             435866..437632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0449"
FT                   /product="sulfate thiol esterase SoxB"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase; InterProIPR006311:
FT                   IPR008334: IPR006179: IPR006146: IPR 017909; KEGG:
FT                   tdn:Suden_0264 sulfate thiol esterase SoxB; PFAM:
FT                   5'-Nucleotidase domain-containing protein; SPTR: Sulfate
FT                   thiol esterase SoxB; PFAM: 5'-nucleotidase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33116"
FT                   /db_xref="GOA:E4TZM8"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM8"
FT                   /protein_id="ADR33116.1"
FT                   /translation="MDLSRRDFFHIAAALGLGAPALASAASGPKRVDEVGLKDIYSFNA
FT                   RGNVTLLHICDMHAHLKPLYWREPSTLISAPNLTGTPGFLCGESFLKHYGMKGKSLDAY
FT                   FDTYMNFDAMAHKFGKMGGIAHMKTLINHIKKERGADNVMLLDSGDTWQGTGVALKTKG
FT                   EAIVKAQNYLGVDVMVGHWEFTYGKTRVKELIEMLNAKFVSQNIIGDDSFADDFEELIF
FT                   EPYTIMERGGAKIGIIGQSFPFTSTANPKEFTQGWSFGLRLDTLQTYVDKLRKEEKVDC
FT                   VVVLSHDGFSVDQEVARQVKGIDFILSGHTHDPSPQPTVINGTVIVIAGSHGKYIGRLD
FT                   IDIKNHKVKGYEYKLIPVAANLIPADPEGEALVKELYSPYDSELSEVLGITKNTLFKRD
FT                   TFHSTFDQLINDSIIDAMDSDISFTPGYRWGTTVLEGDAITMDHVYDMTAITYPNVYTF
FT                   ELTGKHIRTLLEDIADNVFNANPLYQQGGDMSRLGGVTYEIRVGAASGKRITNIMVGGK
FT                   PLSDTKVYKVSSWGGNLQNAGSNLKENLTRPVYDVTSAYIRRQKNVNISGNSNVRLVDY
FT                   DCGCPKKGAKGC"
     MDLSRRDFFH IAAALGLGAP ALASAASGPK RVDEVGLKDI YSFNARGNVT LLHICDMHAH        60
     LKPLYWREPS TLISAPNLTG TPGFLCGESF LKHYGMKGKS LDAYFDTYMN FDAMAHKFGK       120
     MGGIAHMKTL INHIKKERGA DNVMLLDSGD TWQGTGVALK TKGEAIVKAQ NYLGVDVMVG       180
     HWEFTYGKTR VKELIEMLNA KFVSQNIIGD DSFADDFEEL IFEPYTIMER GGAKIGIIGQ       240
     SFPFTSTANP KEFTQGWSFG LRLDTLQTYV DKLRKEEKVD CVVVLSHDGF SVDQEVARQV       300
     KGIDFILSGH THDPSPQPTV INGTVIVIAG SHGKYIGRLD IDIKNHKVKG YEYKLIPVAA       360
     NLIPADPEGE ALVKELYSPY DSELSEVLGI TKNTLFKRDT FHSTFDQLIN DSIIDAMDSD       420
     ISFTPGYRWG TTVLEGDAIT MDHVYDMTAI TYPNVYTFEL TGKHIRTLLE DIADNVFNAN       480
     PLYQQGGDMS RLGGVTYEIR VGAASGKRIT NIMVGGKPLS DTKVYKVSSW GGNLQNAGSN       540
     LKENLTRPVY DVTSAYIRRQ KNVNISGNSN VRLVDYDCGC PKKGAKGC                    588
//

If you have problems or comments...

PBIL Back to PBIL home page