(data stored in ACNUC7421 zone)

EMBL: CP002355.PE449

CP002355.PE449       Location/Qualifiers
FT   CDS             437673..439163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0450"
FT                   /product="outer membrane porin"
FT                   /note="InterPro IPR005318; KEGG: tdn:Suden_0265
FT                   hypothetical protein; PFAM: outer membrane porin; SPTR:
FT                   Putative uncharacterized protein; PFAM: outer membrane
FT                   porin, OprD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33117"
FT                   /db_xref="GOA:E4TZM9"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM9"
FT                   /protein_id="ADR33117.1"
FT                   /translation="MNIMKISMAAAAACLLATSAHALKTEDRDLKGNNIVEYTKAPGDV
FT                   NSIKEMFTEGKVYGRLRSNTFWYNSDNEKSTLQDHNVWGLGGSLVYKTGFFHGFGATAG
FT                   FYGSVPLGSPNVPEGSTTNYGKQGKDIYRTRSDGTEAAMGVVAQAYGEYKISKSNIKLG
FT                   RQMIESTLLSSNDTKMIPNTFTAAVAETKDIKDTTLRAGYITSEKLRNHQEFHSILAYA
FT                   SLTENDDAATHKGLKIANITRAGEDKDPEMVLVTAENKSIPGLKLEGEYYGINGYFSTV
FT                   IAEANYKIGLGNDWTLTPGVRYLRQMDDGAGAIGGASLSGKAATTVNGGTTAGRAAYSD
FT                   ASSVDASMWAARLVAAKGPLELQVGYSKIADDADLITPWRGFPTGGYTRSMGQVDWIAN
FT                   TKNWALKATYDFDKAGLVPGLKISADYENMNFDDSKAATTGFTDRDIIHLDAWQTFKSL
FT                   PNTEFKFRFATIDADPAVGATTDYNSYDEYRFEINYLF"
     MNIMKISMAA AAACLLATSA HALKTEDRDL KGNNIVEYTK APGDVNSIKE MFTEGKVYGR        60
     LRSNTFWYNS DNEKSTLQDH NVWGLGGSLV YKTGFFHGFG ATAGFYGSVP LGSPNVPEGS       120
     TTNYGKQGKD IYRTRSDGTE AAMGVVAQAY GEYKISKSNI KLGRQMIEST LLSSNDTKMI       180
     PNTFTAAVAE TKDIKDTTLR AGYITSEKLR NHQEFHSILA YASLTENDDA ATHKGLKIAN       240
     ITRAGEDKDP EMVLVTAENK SIPGLKLEGE YYGINGYFST VIAEANYKIG LGNDWTLTPG       300
     VRYLRQMDDG AGAIGGASLS GKAATTVNGG TTAGRAAYSD ASSVDASMWA ARLVAAKGPL       360
     ELQVGYSKIA DDADLITPWR GFPTGGYTRS MGQVDWIANT KNWALKATYD FDKAGLVPGL       420
     KISADYENMN FDDSKAATTG FTDRDIIHLD AWQTFKSLPN TEFKFRFATI DADPAVGATT       480
     DYNSYDEYRF EINYLF                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page