(data stored in ACNUC7421 zone)

EMBL: CP002355.PE45

CP002355.PE45        Location/Qualifiers
FT   CDS             complement(44088..44375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_2000 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32713"
FT                   /db_xref="GOA:E4TW97"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW97"
FT                   /protein_id="ADR32713.1"
FT                   /translation="MHQESQQHLFHEEKESLTERYFGLQTYKFFLAAGVVLSVGIYMGF
FT                   IFFGDNSLSVLLDLEEYQDYLSGDIERLKAENAALQKQYFELKELDADSQ"
     MHQESQQHLF HEEKESLTER YFGLQTYKFF LAAGVVLSVG IYMGFIFFGD NSLSVLLDLE        60
     EYQDYLSGDI ERLKAENAAL QKQYFELKEL DADSQ                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page