(data stored in ACNUC7421 zone)

EMBL: CP002355.PE450

CP002355.PE450       Location/Qualifiers
FT   CDS             439174..440079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0451"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: nis:NIS_0439 hypothetical protein; SPTR:
FT                   Metallo-beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33118"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN0"
FT                   /protein_id="ADR33118.1"
FT                   /translation="MKTLLVSFFFAVTSLSAYDYALKPVRVSEDIHCFFGKPEIMDKTN
FT                   NGNIVNSCYIDAKEGYVVVDTGPSYAYAESAYKAMKKIKSLPVKLVINTHIHDDHWLGN
FT                   NYFTEQGIRVVGTDDFKVNADMSVPSRMQTHISADAYSKTVPTMPSEMINSDTTLKIGN
FT                   QTLELKIAKRKAHTAKDMVVFLPKSKVLIAADLVFNDRLPSVRGGDINGWLSALEDLDK
FT                   LDAVHVVGGHGNRTDKDAARMTREYFTQMRTEIRAAIADGLGIDDTIKKVSMDKYKKYK
FT                   LYEETHRHNVESSYRVLEWE"
     MKTLLVSFFF AVTSLSAYDY ALKPVRVSED IHCFFGKPEI MDKTNNGNIV NSCYIDAKEG        60
     YVVVDTGPSY AYAESAYKAM KKIKSLPVKL VINTHIHDDH WLGNNYFTEQ GIRVVGTDDF       120
     KVNADMSVPS RMQTHISADA YSKTVPTMPS EMINSDTTLK IGNQTLELKI AKRKAHTAKD       180
     MVVFLPKSKV LIAADLVFND RLPSVRGGDI NGWLSALEDL DKLDAVHVVG GHGNRTDKDA       240
     ARMTREYFTQ MRTEIRAAIA DGLGIDDTIK KVSMDKYKKY KLYEETHRHN VESSYRVLEW       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page