(data stored in ACNUC7421 zone)

EMBL: CP002355.PE452

CP002355.PE452       Location/Qualifiers
FT   CDS             440526..441425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0268 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33120"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN2"
FT                   /protein_id="ADR33120.1"
FT                   /translation="MKILLVTILAGFLSLFGGDLHLFSVSNADGKYNASVIEKALEANG
FT                   FVISANSEMNGPFKIQFGQSDFSQFNLLTAYHKAHSEALVKANPDAGIFVPMGFGIYQR
FT                   NGDKNLHVSILTAKSMEKIAGFKAKEFALIEKEAIATLKKALSGAKITQSETSLPAEGK
FT                   LLSRFVKASSKESWASDKEETEMMIEDGLKPAGFVMSNFTDYNFALGQKSPFDFYDTYS
FT                   ICKLKVIYTVAKTRPEAAAFAPCTLMVYKKKDADEIVMGFPGVYNWMSSARVDNLEAKE
FT                   TLLQAQKDFEGVLKSVIE"
     MKILLVTILA GFLSLFGGDL HLFSVSNADG KYNASVIEKA LEANGFVISA NSEMNGPFKI        60
     QFGQSDFSQF NLLTAYHKAH SEALVKANPD AGIFVPMGFG IYQRNGDKNL HVSILTAKSM       120
     EKIAGFKAKE FALIEKEAIA TLKKALSGAK ITQSETSLPA EGKLLSRFVK ASSKESWASD       180
     KEETEMMIED GLKPAGFVMS NFTDYNFALG QKSPFDFYDT YSICKLKVIY TVAKTRPEAA       240
     AFAPCTLMVY KKKDADEIVM GFPGVYNWMS SARVDNLEAK ETLLQAQKDF EGVLKSVIE        299
//

If you have problems or comments...

PBIL Back to PBIL home page